PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_22971-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 476aa    MW: 51932 Da    PI: 7.9065
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_22971-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.6e-37102161362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      + +++cprC+s++tkfCy+nny++sqPr+fC++C+ryWt+GG +rnvPvG+grr+nk++s
  TRIUR3_22971-P1 102 DIIVPCPRCNSMETKFCYFNNYNVSQPRHFCRNCQRYWTAGGNIRNVPVGSGRRRNKHAS 161
                      56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2898158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.267105159IPR003851Zinc finger, Dof-type
PfamPF027012.6E-31105159IPR003851Zinc finger, Dof-type
PROSITE patternPS013610107143IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MAALRDRGYA AIKLFGRTIP LLDAAAEVVT KLGNDANSND VMPCVSNKLL NVEATPFCSK  60
NREQNDQAIS KHGVEVRTGF KSEEIKTGSD GSGQDKVLKK PDIIVPCPRC NSMETKFCYF  120
NNYNVSQPRH FCRNCQRYWT AGGNIRNVPV GSGRRRNKHA SHFRHAMMSC DANIAAPGDV  180
SNEIHHLALP LLPQVLPGPI KENKTVKEFG SQVPVCKPMS SIHNIEEQKD THLVALASGD  240
NSEEQSCPSP ATVSGCSENQ TPDSAVKKEP SNVLGYYNGI TLPHPHGPAL VFPWSPGWNS  300
IAVMAAAQCS TEPIQGLENV KHGLPPWAPP LMMAAPGICT PVVPFPMMPP PLWSCIPGWP  360
NGMWSSPCPG NNGPPNKITC SEDNSPTLGK HSRESDLQEE NRENNVQVPK TLRIDDPAEA  420
TKSSVRDTLG IKPDEKGMFK PLQMKVLKND KTPESPQALQ ANPAAFLRSQ SFQERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565663.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLM7ZNU70.0M7ZNU7_TRIUA; Dof zinc finger protein DOF3.3
STRINGMLOC_79421.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-57cycling DOF factor 3